PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g005800.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 298aa    MW: 34496.2 Da    PI: 5.587
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g005800.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1781134356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++ ++q+e Le+ Fe ++++  e++ +LAk++gL+ rqV +WFqNrRa+ k
  Sopim04g005800.0.1  81 KKRRLLPKQVEYLEKSFEVENKLEPERKVQLAKETGLQPRQVAIWFQNRRARCK 134
                         45577899********************************************99 PP

2HD-ZIP_I/II120.86.9e-3980171192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl  +qv+ LE+sFe e+kLeperKv+la+e glqprqva+WFqnrRAR ktkq+Ekdy++Lk+++d+lk++ + L ke+ +Lr+e+
  Sopim04g005800.0.1  80 EKKRRLLPKQVEYLEKSFEVENKLEPERKVQLAKETGLQPRQVAIWFQNRRARCKTKQIEKDYDVLKASFDELKTQYDCLFKENGSLRNEV 170
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Sopim04g005800.0.1 171 H 171
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1965138IPR009057Homeodomain-like
PROSITE profilePS5007116.64976136IPR001356Homeobox domain
SMARTSM003893.8E-1879140IPR001356Homeobox domain
PfamPF000469.6E-1581134IPR001356Homeobox domain
CDDcd000861.01E-1581137No hitNo description
Gene3DG3DSA:1.10.10.603.1E-1984143IPR009057Homeodomain-like
PRINTSPR000313.6E-5107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000313.6E-5116132IPR000047Helix-turn-helix motif
PfamPF021832.7E-17136177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEVARVHEGS NNGFILPNEI LPPTSNWISN SSSIFHGSVS MVNFDQDRVQ KSKKRSFLAQ  60
LDQDDSSSND DNYNYHHQSE KKRRLLPKQV EYLEKSFEVE NKLEPERKVQ LAKETGLQPR  120
QVAIWFQNRR ARCKTKQIEK DYDVLKASFD ELKTQYDCLF KENGSLRNEV HLLKEKLINR  180
VKGKEILEFI SPLDHVEPQN PSIGVDSNLA MVKCKQEDAK SDVLDSDSPR FTDGDYTSYL  240
EPADSSNVFQ TEHSNFSREN DTLCFPKLEE HHHHDDLPVN SCNLGFQIED QSWFSHY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARCKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2800450.0CU280045.2 S.lycopersicum DNA sequence from clone SL_MboI-98C7 on chromosome 4, complete sequence.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237002.10.0PREDICTED: homeobox-leucine zipper protein ATHB-54
TrEMBLK4BNI60.0K4BNI6_SOLLC; Uncharacterized protein
STRINGSolyc04g005800.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-43homeobox 1